PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf04006g01016.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 264aa    MW: 29386.7 Da    PI: 6.692
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf04006g01016.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof117.36.1e-371369561
                    zf-Dof  5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                              a +cprC s ntkfCyynnysl+qPryfCk+CrryWtkGG+lrnvPvGgg+rk+++ 
  Niben101Scf04006g01016.1 13 APTCPRCGSINTKFCYYNNYSLTQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKSRRG 69
                              568**************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-22659IPR003851Zinc finger, Dof-type
PfamPF027011.3E-311468IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.4811468IPR003851Zinc finger, Dof-type
PROSITE patternPS0136101652IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MERGIWKTNV EMAPTCPRCG SINTKFCYYN NYSLTQPRYF CKGCRRYWTK GGSLRNVPVG  60
GGCRKSRRGK SSSSSIRSSS TDHHHGLISR NLGRGIDGLN NPSNNIDQCT ISLAQGGDHQ  120
GPSIDLALVY ANFLNDSSKP QPEVHHQHLE LPELLPNDHH PAVVVGPPFV FSDMINMEFA  180
SDLGQETRLS DGDGVYFSGI DEKQQTMQHV MNHNNDVHYT NMNMNANIIN NELGNYMQLS  240
PLPCEELGVS SQGMAWSNSN DDHM
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009773208.11e-164PREDICTED: dof zinc finger protein DOF2.1-like
RefseqXP_016474876.11e-164PREDICTED: dof zinc finger protein DOF2.1-like
SwissprotQ9SVC53e-44DOF35_ARATH; Dof zinc finger protein DOF3.5
TrEMBLM1BXA01e-84M1BXA0_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000550524e-84(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA129631317
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.12e-33Dof family protein